Antibodies
Product Description | polyclonal antibody to human beta-Endorphin conjugated to BSA |
---|---|
![]() |
|
Formulation | Lyophilized from 10 mM PBS. |
Purification | Whole IgG |
Host Species | Rabbit |
Unit Size: | 50 µg |
Immunogen | Human beta endorphin conjugated to BSA. |
Sequence: | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
Antigen Location (aa): | 1-31 |
Alternative Names | N/A |
Accession Number: | P01189 |
Accession Name: | COLI_HUMAN |
Accession URL: | http://www.uniprot.org/uniprot/P01189 |
Function: | beta Endorphin is an endogenous opioid peptide that interacts with mu-opioid receptors a, like morphine, produces analgesic effects. |
Applications: | Recommended for Immunohistochemistry (IHC), Cytochemistry (ICC) and RIA. |
Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
IHC Positive control: | Brain (PAG) |
Specificity: | Confirmed by RIA against the synthetic peptide. |
Cross-reactivity: | Human; mouse; rat. Beta-endorphin is a highly conserved molecule, so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%. |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References:
|